Anti-FOXD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 8-22 amino acids of Human forkhead box D2 |
Anti-FOXD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 8-22 amino acids of Human forkhead box D2 |
Anti-FOXD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 9-22 amino acids of Human forkhead box D2 |
Rabbit Polyclonal Anti-Foxd2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC |
Rabbit Polyclonal anti-FOXD2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXD2 antibody: synthetic peptide directed towards the N terminal of human FOXD2. Synthetic peptide located within the following region: LPARSGPRAPRDVLPHGHEPPAEEAEADLAEDEEESGGCSDGEPRALASR |