Antibodies

View as table Download

EIF4A3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EIF4A3

EIF4A3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EIF4A3

Rabbit Polyclonal Anti-EIF4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4A3 antibody: synthetic peptide directed towards the N terminal of human EIF4A3. Synthetic peptide located within the following region: RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL

Rabbit Polyclonal Anti-DDX48 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX48 antibody: synthetic peptide directed towards the middle region of human DDX48. Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

eIF4A3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human eIF4A3 (NP_055555.1).
Modifications Unmodified