Antibodies

Jump to Filters
View as table Download
Coilin (COIL) (Center) Rabbit Polyclonal Antibody
AP51008PU-N

USD 580.00

2 Weeks

Coilin (COIL) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 156-186 amino acids from the Central region of human COIL
Coilin (COIL) Rabbit Polyclonal Antibody
TA335742

USD 539.00

5 Days

Rabbit Polyclonal Anti-COIL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COIL Antibody: synthetic peptide directed towards the C terminal of human COIL. Synthetic peptide located within the following region: DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ