Antibodies

View as table Download

Rabbit Polyclonal Anti-CDC37L1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC37L1

CDC37L1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC37L1

Rabbit polyclonal antibody to CDC37L1 (cell division cycle 37 homolog (S. cerevisiae)-like 1)

Applications WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 275 and 337 of CDC37L1 (Uniprot ID#Q7L3B6)

Rabbit Polyclonal Anti-CDC37L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC37L1 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC37L1. Synthetic peptide located within the following region: AEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSV

CDC37L1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

CDC37L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDC37L1