Antibodies

Jump to Filters
View as table Download
Apolipoprotein H (APOH) Mouse Monoclonal Antibody [Clone ID: OTI4A11]
CF807147

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Apolipoprotein H (APOH) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF807179

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Apolipoprotein H (APOH) Mouse Monoclonal Antibody [Clone ID: OTI10A6]
TA807230

USD 447.00

In Stock

APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Apolipoprotein H (APOH) Rabbit Polyclonal Antibody
TA323752

USD 380.00

In Stock

Anti-APOH Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-262 amino acids of human apolipoprotein H (beta-2-glycoprotein I)
TA323752 is a possible alternative to TA323751.
Apolipoprotein H (APOH) Mouse Monoclonal Antibody [Clone ID: OTI10A6]
CF807230

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Apolipoprotein H (APOH) Rabbit Polyclonal Antibody
TA323751

USD 380.00

In Stock

Anti-APOH Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 21-262 amino acids of human apolipoprotein H (beta-2-glycoprotein I)
Apolipoprotein H (APOH) Goat Polyclonal Antibody
AP31279PU-N

USD 500.00

2 Weeks

Apolipoprotein H (APOH) goat polyclonal antibody, Aff - Purified

Applications ELISA, ID, IHC
Reactivities Canine, Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Purified beta2-Glycoprotein-I (beta2GP-I) from human plasma. This protein is also known as apolipoprotein-H.
Apolipoprotein H (APOH) Goat Polyclonal Antibody
TA318083

USD 660.00

In Stock

APOH / Apolipoprotein H Goat Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen APOH / Apolipoprotein H antibody was raised against human beta2-Glycoprotein-I (beta2GP-I) purified from plasma.
Apolipoprotein H (APOH) Rabbit Polyclonal Antibody
TA327006

USD 365.00

3 Weeks

APOH Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human APOH
Apolipoprotein H (APOH) Rabbit Polyclonal Antibody
TA339868

USD 539.00

5 Days

Rabbit Polyclonal Anti-APOH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOH antibody: synthetic peptide directed towards the middle region of human APOH. Synthetic peptide located within the following region: PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG
Apolipoprotein H (APOH) Goat Polyclonal Antibody
TA309541

USD 520.00

5 Days

Goat Polyclonal Antibody against APOH (aa145-157)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PSIPTFATLRVYK, from the internal region of the protein sequence according to NP_000033.2.