APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
APBB3 mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to APBB3 (amyloid beta (A4) precursor protein-binding, family B, member 3)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 242 and 486 of APBB3 (Uniprot ID#O95704) |
Rabbit polyclonal APBB3 Antibody (Center)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This APBB3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-214 amino acids from the Central region of human APBB3. |
Rabbit Polyclonal Anti-APBB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APBB3 antibody: synthetic peptide directed towards the N terminal of human APBB3. Synthetic peptide located within the following region: SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR |
APBB3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human APBB3 |
APBB3 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
APBB3 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from C-terminal domain of Human Fe65L2 protein isoform I-214 |