Rabbit Polyclonal ZBTB7A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZBTB7A antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human ZBTB7A. |
Rabbit Polyclonal ZBTB7A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ZBTB7A antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human ZBTB7A. |
Rabbit Polyclonal Anti-ZBTB7A Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the N terminal of mouse ZBTB7A. Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF |
Zbtb7a Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |