Antibodies

View as table Download

LAMP3 rat monoclonal antibody, clone 1010E1.01

Applications IHC
Reactivities Canine, Feline, Human, Mouse, Sheep
Conjugation Unconjugated

Lamp3 rat monoclonal antibody, clone 1006F7.05

Applications FC, IF, IHC
Reactivities Mouse
Conjugation Unconjugated

LAMP3 mouse monoclonal antibody, clone 104G4

Applications FC, IF, IHC
Reactivities Human, Sheep
Conjugation Unconjugated

Anti-LAMP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-66 amino acids of Human lysosomal-associated membrane protein 3

Anti-LAMP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-66 amino acids of Human lysosomal-associated membrane protein 3

LAMP3 mouse monoclonal antibody, clone 109G3

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

LAMP3 mouse monoclonal antibody, clone 109G3

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal LAMP3 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LAMP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 8-38 amino acids from the N-terminal region of human LAMP3.

LAMP3 mouse monoclonal antibody, clone 208B5

Applications FC, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-LAMP3 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMP3.

Rabbit Polyclonal Anti-LAMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT