Rabbit Polyclonal Anti-ARC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-ARC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARC |
Rabbit Polyclonal Anti-KIR2DL3/1/4/S4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIR2DL3/1/4/S4 |
KIR2DL3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KIR2DL3 |
KIR2DL3 mouse monoclonal antibody, clone 190IIC311, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KIR2DL3 mouse monoclonal antibody, clone 190IIC311, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
KIR2DL2/3 Rabbit polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human KIR2DL3/KIR2DS2. AA range:131-180 |
Rabbit Polyclonal Anti-KIR2DL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIR2DL3 antibody is: synthetic peptide directed towards the middle region of Human KIR2DL3. Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP |
CD158b2 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD158b2. |
KIR2DL3 mouse monoclonal antibody, clone GL183, Purified
Applications | FC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |