Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Antibodies
View as table Download
KIR2DL3 mouse monoclonal antibody, clone 190IIC311, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KIR2DL3 mouse monoclonal antibody, clone 190IIC311, Purified
| Applications | ELISA, FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KIR2DL2/3 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human KIR2DL3/KIR2DS2. AA range:131-180 |
Rabbit Polyclonal Anti-KIR2DL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIR2DL3 antibody is: synthetic peptide directed towards the middle region of Human KIR2DL3. Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP |
CD158b2 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD158b2. |
KIR2DL3 mouse monoclonal antibody, clone GL183, Purified
| Applications | FC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- KIR2DL3
Conjugates
- Unconjugated