Rabbit Polyclonal Anti-CADM3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CADM3 |
Rabbit Polyclonal Anti-CADM3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CADM3 |
Rabbit Polyclonal Anti-CADM3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CADM3 antibody was raised against a 16 amino acid peptide near the center of human CADM3. |
CADM3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CADM3 |
Rabbit polyclonal anti-CADM3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CADM3. |
Rabbit Polyclonal Anti-CADM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CADM3 antibody: synthetic peptide directed towards the middle region of human CADM3. Synthetic peptide located within the following region: KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV |
CADM3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CADM3 |
CADM3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-330 of human CADM3 (NP_001120645.1). |
Modifications | Unmodified |