Rabbit Polyclonal Anti-CDC37L1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDC37L1 |
Rabbit Polyclonal Anti-CDC37L1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDC37L1 |
CDC37L1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDC37L1 |
Rabbit polyclonal antibody to CDC37L1 (cell division cycle 37 homolog (S. cerevisiae)-like 1)
Applications | WB |
Reactivities | Human (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 275 and 337 of CDC37L1 (Uniprot ID#Q7L3B6) |
Rabbit Polyclonal Anti-CDC37L1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC37L1 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC37L1. Synthetic peptide located within the following region: AEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSV |
CDC37L1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CDC37L1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CDC37L1 |