MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAP3K8 mouse monoclonal antibody,clone OTI2E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody,clone OTI2E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MAP3K8 mouse monoclonal antibody,clone OTI2E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal COT (Ab-290) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I). |
Rabbit polyclonal MAP3K8 (Ab-400) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D). |
MAP3K8 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 250-300 of Human Cot. |
MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal COT Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human COT |
Rabbit Polyclonal COT (Thr290) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human COT around the phosphorylation site of Threonine 290 |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-MAP3K8 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the C terminal of human MAP3K8. Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY |
Rabbit Polyclonal anti-MAP3K8 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the N terminal of human MAP3K8. Synthetic peptide located within the following region: ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL |