Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI1A7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C2 mouse monoclonal antibody,clone OTI12G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Complement C2 (complement component 2)
Applications | IF, WB |
Reactivities | Human (Predicted: Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681) |
C2 mouse monoclonal antibody,clone OTI1A7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
C2 rabbit polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The C2 component of human complement is a single-chain polypeptide with a molecular weight of 110,000. It is present in plasma in an average concentration of 25 μg/ml. The activated form of C2 combines with the activated C4 to form a complex with C3-convertase activity in the classical pathway of complement activation. C2 is isolated as a homogenous protein for use in the antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Hamster, Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2 |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
C2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C2 |
C4BPA rabbit polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | C4-binding protein is a plasma protein with a molecular weight of 500,000 and consists of 6 chains. Its concentration in serum is about 250 μg/ml. It is one of the inhibitors of the complement activation system. The protein combines up to six molecules of C4b at or near the C2 combining site and is thus preventing further association with C2. It has been isolated as a homogenous protein for use in the antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure |