Antibodies

Jump to Filters
View as table Download
IFNGR1 Rabbit Polyclonal Antibody
AP20248PU-N

USD 465.00

3 Weeks

IFNGR1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 430-480 of Human IFN-γRα
IFNGR1 Rabbit Polyclonal Antibody
TA332883

USD 365.00

3 Weeks

Rabbit anti-IFNGR1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNGR1
IFNGR1 (C-term) Rabbit Polyclonal Antibody
AP52156PU-N

USD 580.00

2 Weeks

IFNGR1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 460-489 amino acids from the C-terminal region of human IFNGR1
IFNGR1 Rabbit Polyclonal Antibody
TA343330

USD 539.00

5 Days

Rabbit Polyclonal Anti-IFNGR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNGR1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNGR1. Synthetic peptide located within the following region: EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS
IFNGR1 Rabbit Polyclonal Antibody
TA363755

USD 539.00

5 Days

IFNGR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human IFNGR1