Mouse Monoclonal SREBP1 Antibody (2A4)
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Golden Syrian Hamster |
Conjugation | Unconjugated |
Mouse Monoclonal SREBP1 Antibody (2A4)
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Golden Syrian Hamster |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of human SREBF1. Synthetic peptide located within the following region: AGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGS |
Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR |
Rabbit Polyclonal SREBP-1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 |
Rabbit Polyclonal SREBP-1 (Ser439) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 around the phosphorylation site of Serine 439 |
Modifications | Phospho-specific |
SREBP1 (SREBF1) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SREBF1 |