Antibodies

View as table Download

Rabbit Polyclonal Anti-C4BPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4BPA antibody: synthetic peptide directed towards the middle region of human C4BPA. Synthetic peptide located within the following region: QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL

C4BPA mouse monoclonal antibody, clone 10-07, Purified

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated