Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey |
Conjugation | Unconjugated |
Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey |
Conjugation | Unconjugated |
ACAA1 mouse monoclonal antibody,clone OTI4F1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACAA1 mouse monoclonal antibody,clone OTI4F1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
ACAA1 mouse monoclonal antibody,clone OTI4F1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FADS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FADS1 |
Anti-PECR mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey |
Conjugation | Unconjugated |
Anti-ACOX1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA oxidase 1, palmitoyl |
Rabbit Polyclonal Anti-HSD17B12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
Rabbit Polyclonal Anti-ACAA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD |
Anti-ACOT2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2 |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Rabbit anti-HADHA Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HADHA |