Antibodies

View as table Download

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TBXAS mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700230, TA700234

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TBXAS1

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TBXAS mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700230

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TBXAS mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700230, TA700231, TA700232

TBXAS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 234-266 amino acids from the Central region of Human CYP5A1.

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-THAS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human THAS.

Rabbit anti-TBXAS1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBXAS1

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV

TBXAS mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700233