Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Goat, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211). |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit polyclonal TNF Receptor-1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Tnfrsf1a rabbit polyclonal antibody, Purified
Applications | ELISA, FN, IP, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
TNFRSF1A rabbit polyclonal antibody, Purified
Applications | ELISA, FC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Tnfrsf1a hamster monoclonal antibody, clone 55R-170, Purified
Applications | ELISA, FN, IP |
Reactivities | Mouse |
Conjugation | Unconjugated |