Antibodies

View as table Download

GRHL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human GRHL2 (NP_079191.2).
Modifications Unmodified

Rabbit Polyclonal Anti-Grhl2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Grhl2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Grhl2. Synthetic peptide located within the following region: MPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGL