Antibodies

View as table Download

Rabbit Polyclonal Anti-HTR3B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR3B

HTR3B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR3B

Rabbit Polyclonal Anti-HTR3B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT

Goat Anti-Serotonin Receptor 3B / HTR3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNYLQTQDQTDQQE, from the internal region (near C-terminus) of the protein sequence according to NP_006019.1.