Antibodies

View as table Download

Anti-SLC2A6 (GLUT6) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SLC2A6 mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SLC2A6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A6 Antibody: synthetic peptide directed towards the C terminal of human SLC2A6. Synthetic peptide located within the following region: AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL

Rabbit Polyclonal Anti-SLC2A6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A6 Antibody: synthetic peptide directed towards the N terminal of human SLC2A6. Synthetic peptide located within the following region: VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV