Antibodies

View as table Download

Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85)

Rabbit Polyclonal Anti-CAMK1D Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAMK1D

Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 205 of CaMK1D (Uniprot ID#Q8IU85)

Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 81 and 385 of CAMK1D (Uniprot ID#Q8IU85)

Goat Anti-CAMK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ASQKDCAYVAKPES, from the C Terminus of the protein sequence according to NP_065130.1.

Rabbit Polyclonal Anti-CAMK1D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Rabbit Polyclonal Anti-CAMK1D Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Camk1d antibody is: synthetic peptide directed towards the N-terminal region of Mouse Camk1d. Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY