Antibodies

View as table Download

Anti-ADAMTS18 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human ADAM metallopeptidase with thrombospondin type 1 motif, 18

Rabbit polyclonal anti-ADAMTS18 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADAMTS18.

Rabbit Polyclonal Anti-ADAMTS18 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADAMTS18

Rabbit Polyclonal Anti-ADAMTS18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAMTS18 antibody: synthetic peptide directed towards the N terminal of human ADAMTS18. Synthetic peptide located within the following region: FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS