Antibodies

View as table Download

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG

Rabbit polyclonal PLG Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG.

Plasminogen (PLG) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen isolated and purified from Human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Plasminogen (PLG) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen isolated and purified from Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit polyclonal anti-PLG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human PLG.

Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PLMN.

Rabbit Polyclonal Anti-PLG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLG antibody: synthetic peptide directed towards the middle region of human PLG. Synthetic peptide located within the following region: LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE