Antibodies

View as table Download

PTEN mouse monoclonal antibody, clone OTI5A5 (formerly 5A5)

Applications IHC
Reactivities Mouse, Rat
Conjugation Unconjugated

PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Reactivities Human
Conjugation Unconjugated

PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PTEN mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Reactivities Human
Conjugation Unconjugated

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PTEN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 381-396 amino acids of human phosphatase and tensin homolog

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.

Rabbit Polyclonal PTEN Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PTEN antibody was raised against a 15 amino acid peptide from near the amino terminus of human PTEN.

Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S).
Modifications Phospho-specific

Rabbit polyclonal PTEN(Ab-380/382/383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383.

Rabbit Polyclonal Anti-SYNJ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ1 antibody: synthetic peptide directed towards the N terminal of human SYNJ1. Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Rabbit anti pTEN(pS380) Polyclonal Antibody

Applications Dot, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -DTSDP-- with phosphorylation sites at Ser385 of PTEN protein from human, mouse and rat origins.

Rabbit anti pTEN Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human PTEN protein. This sequence is identical among human, mouse, rat origins.