Antibodies

View as table Download

Anti-GRIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 35-49 amino acids of human glutamate receptor, ionotropic, N-methyl D-aspartate 1

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Rat, Mouse, Human
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A

Anti-GRIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 35-49 amino acids of human glutamate receptor, ionotropic, N-methyl D-aspartate 1

Anti-GRIN2D Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1264-1278 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2D

Glutamate receptor ionotropic, NMDA 2D (GRIN2D) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 860-910 of Human NMDAζ1.

Rabbit polyclonal GRIN2B(Ab-1303) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D).

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIN2A

NMDAR1 (GRIN1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1

Rabbit Polyclonal NMDAR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR1

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

NMDAR2B (GRIN2B) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the C-terminus of Human NMDAε2

NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping at the N-terminus of NMDAR2B of human origin