Antibodies

View as table Download

Rabbit Polyclonal Anti-Kcnq3 Antibody

Applications WB
Reactivities Mouse, Hamster
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ

KCNQ3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 650-679 amino acids from the C-terminal region of human KCNQ3

Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K).
Modifications Phospho-specific