Antibodies

Jump to Filters
View as table Download
SYT homolog 1 (SS18L1) Rabbit Polyclonal Antibody
TA333342

USD 539.00

In Stock

Rabbit Polyclonal Anti-SS18L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SS18L1 Antibody: synthetic peptide directed towards the middle region of human SS18L1. Synthetic peptide located within the following region: EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ
SYT homolog 1 (SS18L1) Rabbit Polyclonal Antibody
TA360399

USD 539.00

5 Days

SS18L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SS18L1