Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SNAP29 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human SNAP29 (NP_004773.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-SNAP29 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK |
Rabbit Polyclonal Anti-SNAP29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAP29 antibody: synthetic peptide directed towards the middle region of human SNAP29. Synthetic peptide located within the following region: QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP |
Snap29 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SNAP29
Clonalities
- Polyclonal