SLC35B1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC35B1 |
SLC35B1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC35B1 |
Rabbit Polyclonal Anti-SLC35B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC35B1 Antibody: synthetic peptide directed towards the C terminal of human SLC35B1. Synthetic peptide located within the following region: ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT |
SLC35B1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC35B1 |