Antibodies

View as table Download

SIGLEC10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC10

Rabbit Polyclonal Anti-SIGLEC10 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC10

SIGLEC10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIGLEC10.
Modifications Unmodified

Rabbit Polyclonal Anti-SIGLEC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC10 antibody: synthetic peptide directed towards the middle region of human SIGLEC10. Synthetic peptide located within the following region: CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL

Anti-Hu SIGLEC10 PE

Applications FC
Reactivities Human
Conjugation Unconjugated
Immunogen SIGLEC10 extracellular domain fused with human IgG1 Fc fragment