Antibodies

Jump to Filters
View as table Download
PI4KB (Center) Rabbit Polyclonal Antibody
AP17647PU-N

USD 580.00

2 Weeks

PI4KB (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 519-548 amino acids from the Center region of Human PIK4CB.
PI4KB Rabbit Polyclonal Antibody
TA379907

USD 365.00

3 Weeks

PI4KB Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 560-801 of human PI4KB (NP_001185702).
Modifications Unmodified
PI4KB Rabbit Polyclonal Antibody
TA337683

USD 539.00

5 Days

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN
PI4KB Rabbit Polyclonal Antibody
TA397527

USD 765.00

5 Days

PI4K Beta Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-PI4K beta affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PI4K beta protein.
PI4KB Rabbit Polyclonal Antibody
TA337684

USD 539.00

5 Days

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the middle region of human PI4KB. Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM