Antibodies

Jump to Filters
View as table Download
PCDH18 Rabbit Polyclonal Antibody
TA306745

USD 570.00

5 Days

Rabbit Polyclonal PCDH18 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PCDH12 antibody was raised against a 17 amino acid peptide near the amino terminus of human PCDH12.
PCDH18 Rabbit Polyclonal Antibody
TA331079

USD 539.00

5 Days

Rabbit polyclonal Anti-PCDH18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDH18 antibody: synthetic peptide directed towards the N terminal of human PCDH18. Synthetic peptide located within the following region: MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSED