Antibodies

Jump to Filters
View as table Download
Myostatin Propeptide (MSTN) Rabbit Polyclonal Antibody
TA343358

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-MSTN Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mstn antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mstn. Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN
Myostatin Propeptide (MSTN) Rabbit Polyclonal Antibody
TA321697

USD 380.00

In Stock

Anti-MSTN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 354-366 amino acids of Human myostatin
Myostatin Propeptide (MSTN) Rabbit Polyclonal Antibody
TA354901

USD 425.00

5 Days

Rabbit anti GDF-8 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated