Germany
Japan
United Kingdom
China
LCOR (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 329-358 amino acids from the C-terminal region of Human LCOR |
Antibodies
View as table Download
Rabbit polyclonal anti-A630025C20RIK antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A630025C20RIK antibody: synthetic peptide directed towards the N terminal of mouse A630025C20RIK. Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK |
Rabbit Polyclonal Anti-LCOR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCOR antibody: synthetic peptide directed towards the C terminal of human LCOR. Synthetic peptide located within the following region: EGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHS |
Rabbit Polyclonal Anti-LCOR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCOR antibody: synthetic peptide directed towards the middle region of human LCOR. Synthetic peptide located within the following region: NLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVD |
Active filters
Target Symbol
- LCOR
Clonalities
- Polyclonal