Rabbit Polyclonal Anti-ETFA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETFA Antibody: synthetic peptide directed towards the N terminal of human ETFA. Synthetic peptide located within the following region: FRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEV |
ETFA (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the C Terminus of the protein sequence according to NP_000117.1 and NP_001121188.1. |
Goat Anti-ETFA (aa139-152) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Pig, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KSPDTFVRTIYAGN, from the internal region of the protein sequence according to NP_000117.1; NP_001121188.1. |
Rabbit Polyclonal Anti-ETFA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETFA Antibody: synthetic peptide directed towards the middle region of human ETFA. Synthetic peptide located within the following region: VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG |
ETFA Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ETFA |
Germany
Japan
United Kingdom
China
