Antibodies

View as table Download

DYNLRB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DYNLRB1

Rabbit Polyclonal Anti-DYNLRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYNLRB1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNLRB1. Synthetic peptide located within the following region: VNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR

DYNLRB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DYNLRB1

DYNLRB1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1).
Modifications Unmodified

Rabbit Polyclonal Anti-DYNLRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYNLRB1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNLRB1. Synthetic peptide located within the following region: EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILK