Antibodies

View as table Download

DNMT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DNMT1.
Modifications Unmodified

DNMT1 Rabbit polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein of Human DNMT1.
Modifications Unmodified

DNMT1 Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human DNMT1 (NP_001370.1).
Modifications Unmodified

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1
TA323184 is a possible alternative to TA323183.

Rabbit Polyclonal DNMT1 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein.

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

DNMT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DNMT1.

Dnmt1 Rabbit polyclonal Antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Dnmt1

DNMT1 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Dnmt1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human Dnmt1.

Goat Polyclonal Antibody against DNMT1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFESPPKTQPTEDN, from the internal egion of the protein sequence according to NP_001370.1.

Rabbit Polyclonal Anti-Dnmt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dnmt1 antibody: synthetic peptide directed towards the N terminal of mouse Dnmt1. Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR

Dnmt1 Antibody - Middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the Middle region of Human Dnmt1

DNMT1 pSer714 rabbit polyclonal antibody, Aff - Purified

Reactivities Human
Conjugation Unconjugated
Immunogen This Dnmt1 antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Ser714 of human Dnmt1.

DNMT1 pSer154 rabbit polyclonal antibody, Aff - Purified

Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S154 of human Dnmt1.