Antibodies

View as table Download

Rabbit Polyclonal Anti-CRBN Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CRBN antibody was raised against a 16 amino acid peptide near the carboxy terminus of human CRBN.

Rabbit Polyclonal Anti-CRBN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRBN antibody: synthetic peptide directed towards the N terminal of human CRBN. Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL

CRBN Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CRBN

CRBN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human CRBN (NP_001166953.1).
Modifications Unmodified