Coilin (COIL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 156-186 amino acids from the Central region of human COIL |
Coilin (COIL) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 156-186 amino acids from the Central region of human COIL |
Rabbit Polyclonal Anti-COIL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-COIL Antibody: synthetic peptide directed towards the C terminal of human COIL. Synthetic peptide located within the following region: DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ |