Antibodies

View as table Download

Rabbit Polyclonal Anti-SIGLEC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC7

Rabbit Polyclonal Anti-SIGLEC7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC7

Rabbit Polyclonal Anti-SIGLEC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC7 antibody: synthetic peptide directed towards the middle region of human SIGLEC7. Synthetic peptide located within the following region: WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL

Rabbit Polyclonal Anti-SIGLEC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC7 antibody: synthetic peptide directed towards the middle region of human SIGLEC7. Synthetic peptide located within the following region: WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ