Antibodies

View as table Download

HRH3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HRH3

Rabbit Polyclonal Anti-HRH3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HRH3

HRH3 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HRH3 (NP_009163.2).
Modifications Unmodified

Rabbit Polyclonal Anti-H3 Histamine Receptor

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RTRLRLDGGREAGPE, corresponding to amino acids 228-242 of rat H3 Histamine Receptor. 3rd intracellular loop.

HRH3 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between aa 414 - 442 from the C-terminal region of human HRH3.

Histamine 3 Receptor / HRH3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Gibbon
Conjugation Unconjugated
Immunogen HRH3 / Histamine 3 Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human HRH3 / Histamine H3 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Hamster, Elephant, Bovine, Dog, Horse, Opossum, Guinea pig, Platypus (88%); Bat, Turkey (81%).

HRH3 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 300-350 of Human Histamine H3 Receptor.

Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)

Applications IHC, WB
Reactivities Human (Predicted: Rat, Rabbit, Guinea Pig, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1)

Histamine 3 Receptor / HRH3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Bovine, Gorilla, Human, Monkey, Mouse, Rat, Gibbon, Hamster, Horse, Guinea Pig (Predicted: Bat, Dog)
Conjugation Unconjugated
Immunogen HRH3 / Histamine 3 Receptor antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human HRH3 / Histamine H3 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Guinea pig (100%); Panda, Bat, Dog (94%); Opossum (81%).

HRH3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human HRH3

Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)

Applications WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 299 and 389 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1)

Goat Anti-histamine H3 receptor Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SVTRAVSYRAQQGDT, from the internal region of the protein sequence according to NP_009163.2.

Rabbit Polyclonal Anti-HRH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HRH3 antibody is: synthetic peptide directed towards the C-terminal region of Human HRH3. Synthetic peptide located within the following region: LGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMV

Rabbit Polyclonal Anti-HRH3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Hrh3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hrh3. Synthetic peptide located within the following region: VFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAI