Antibodies

View as table Download

FGF2 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 143-288 of human FGF2 (NP_001997.5).
Modifications Unmodified

Rabbit Polyclonal Anti-FGF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

FGF2 rabbit polyclonal antibody, Azide Free

Applications ELISA, FN, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%) recombinant Human FGF-2 (basic) [Ala136 – Ser288] produced in E.coli (Cat.-No DA3503XC).

FGF2 rabbit polyclonal antibody, Azide Free

Applications ELISA, FN, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%) recombinant Human FGF-2 (basic) [Ala136 – Ser288] produced in E.coli (Cat.-No DA3503XC).

FGF2 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human FGF2. AA range:151-200

FGF2 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure recombinant human FGF-2 (hFGF-2)

FGF2 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure recombinant human FGF-2 (hFGF-2)

FGF2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide mapping near the N-terminal of Human FGF2, identical to the related Rat and Mouse sequence

Anti-FGF2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-229 amino acids of Human Fibroblast growth factor 2

Rabbit polyclonal anti-FGF2 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF2

FGF2 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen E.coli-derived, 17.2 kDa Recombinant Human FGF-basic (Cat.-No PA055).

FGF2 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen E.coli-derived, 17.2 kDa Recombinant Human FGF-basic (Cat.-No PA055).

FGF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF2.

FGF2 rabbit polyclonal antibody, Serum

Applications IHC, R, WB
Reactivities Bovine
Conjugation Unconjugated
Immunogen Recombinant Bovine Fibroblast Growth Factor-2 [FGF-2] (= basic FGF)