Rabbit polyclonal Anti-Kir1.1
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1, (MW: 33 kDa). Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNJ1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP |
Goat Anti-KCNJ1 / ROMK Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQININFVVDAGNEN , from the internal region of the protein sequence according to NP_000211.1; NP_722448.1. |
KCNJ1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse KCNJ1 |
Germany
Japan
United Kingdom
China
