RPIA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 82-311 of human RPIA (NP_653164.2). |
| Modifications | Unmodified |
Rpia (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of mouse Rpia |
Rabbit Polyclonal Anti-RPIA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPIA Antibody: synthetic peptide directed towards the N terminal of human RPIA. Synthetic peptide located within the following region: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG |
Germany
Japan
United Kingdom
China