Antibodies

View as table Download

OLFM4 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-510 of human OLFM4 (NP_006409.3).
Modifications Unmodified

OLFM4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Dog, Gorilla, Human, Orang-Utan (Predicted: Monkey)
Conjugation Unconjugated
Immunogen OLFM4 / Olfactomedin 4 antibody was raised against synthetic 15 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Dog (100%); Gibbon, Monkey, Panda (93%); Marmoset, Bat (87%); Hamster, Rabbit, Pig (80%).

Rabbit Polyclonal Anti-OLFM4 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLFM4

Rabbit Polyclonal Anti-OLFM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

OLFM4 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLFM4

Rabbit Polyclonal OLFM4 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 400 and 450 of human OLFM4 was used as immunogen for this antibody.