Antibodies

View as table Download

Rabbit Polyclonal CTTNBL1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1.

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications IF, IHC, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

Rabbit Polyclonal Anti-CTNNBL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CTNNBL1

Rabbit Polyclonal Anti-DDX39B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDX39B

Rabbit Polyclonal Anti-HNRNPM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPM

Rabbit polyclonal Hsp70 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Dog, Guinea Pig, Monkey, Pig, Sheep, Beluga, Cow, Hamster, Coral, Tomato, Tobacco, Dogfish, Hagfish, Carp
Conjugation Unconjugated
Immunogen Full length human protein Hsp70

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Rabbit Polyclonal Anti-CDC5L Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDC5L

Rabbit polyclonal hnRNP C1/C2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2.

Goat Polyclonal Antibody against PRPF31

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence KELGNSLDKCKNNEN, from the internal region of the protein sequence according to NP_056444.2.

Rabbit Polyclonal Anti-RBMX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBMX

Rabbit polyclonal antibody to SAP130 (splicing factor 3b, subunit 3, 130kDa)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1154 and 1217 of SAP130 (Uniprot ID#Q15393)

Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Zebrafish, Rat, Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1)

Rabbit polyclonal anti-hnRNP A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from inetrnal of human hnRNP A1.