Antibodies

Jump to Filters
View as table Download
CRY2 Rabbit Polyclonal Antibody
TA340193

USD 539.00

5 Days

Rabbit Polyclonal Anti-CRY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
CRY2 (C-term) Rabbit Polyclonal Antibody
AP13098PU-N

USD 580.00

2 Weeks

CRY2 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CRY2.