Rabbit polyclonal antibody to RPB8 (polymerase (RNA) II (DNA directed) polypeptide H)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Chicken, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of RPB8 (Uniprot ID#P52434) |
Rabbit polyclonal anti-RPAB1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced againstsynthesized peptide derived from internal of human RPAB1. |
Rabbit polyclonal anti-NT5E antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Rabbit polyclonal anti-POLD3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD3. |
Rabbit polyclonal anti-ADCY4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY4. |
Rabbit polyclonal POLD2 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Rabbit anti-HPRT1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HPRT1 |
Rabbit polyclonal Anti-Pde2a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pde2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG |
Rabbit Polyclonal Anti-XDH Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS |
Rabbit Polyclonal Anti-NM23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NM23 Antibody: A synthesized peptide derived from human NM23 |
Rabbit Polyclonal Anti-GCYB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCYB1 Antibody: A synthesized peptide derived from human GCYB1 |
Germany
Japan
United Kingdom
China